Explicit content
Discover comprehensive guidance and resources at orientacionandujar.es, a dedicated platform for educational support and psychological orientation. Whether you are a student seeking academic assistance, a parent looking for parenting tips, or an educator aiming to enhance classroom experience, this website offers valuable insights, tools, and expert advice. Explore articles, workshops, and personalized consultations that cater to diverse needs, fostering growth and development in a nurturing environment. Engage with an active community passionate about education and well-being, where knowledge is shared and everyone’s journey is supported.
Rank by traffic
In June 2025, orientacionandujar.es saw a decrease in search traffic, reaching 231K visits, which is a decrease of 8.4K visits compared to the previous month. The traffic value increased to 22K, a growth of 127.
For orientacionandujar.es, Mexico dominates traffic with 72K visits, a decrease of 7.7K from the previous month, making up 31.2% of the total traffic.
orientacionandujar.es ranks #1 for "frases para fichas descriptivas de alumnos de primaria" in Mexico and receives 1.6K monthly visits from this keyword alone, an increase of 813 from the previous month.
Keyword | Volume | Traffic | Position | ||||||
|---|---|---|---|---|---|---|---|---|---|
| frases para fichas descriptivas de alumnos de primaria | 2.6K | +1.3K | 1.6K | +813 | 1 | ||||
| ficha descriptiva del alumno | 5.1K | −1.2K | 1.3K | +23 | 2 → 1 | ||||
| problemas matematicos para quinto grado | 1.7K | 1.3K | −2 | 1 | |||||
| 10 palabras agudas | 4.4K | −6.6K | 1.1K | −1.6K | 1 | ||||
| palabras con tr | 2.8K | −5.2K | 976 | −1.8K | 1 | ||||
edufichas.com, actividadesdeinfantilyprimaria.com and imageneseducativas.com rank in the top 10 organic search results for the same keywords that orientacionandujar.es gets the most traffic from. Discover more competitors of orientacionandujar.es.
Website | Traffic | Pages | |||||||
|---|---|---|---|---|---|---|---|---|---|
| edufichas.com | 135K | 418 | |||||||
| actividadesdeinfantilyprimaria.com | 50K | 3.5K | |||||||
| imageneseducativas.com | 112K | 5.2K | |||||||
| oei.int | 102K | 1.3K | |||||||
| twinkl.com.mx | 527K | 10K | |||||||
As of June 2025, orientacionandujar.es's Domain Rating is 61. orientacionandujar.es is linked by 27K websites, indicating a decrease of 265 referring sites from the previous month.
Get an in-depth look at the organic search traffic and backlink profile of any website or URL.