"orientacionandujar.es" is a comprehensive website that offers a wide range of educational resources and materials for teachers, parents, and students. With a focus on promoting learning and development, the site provides innovative teaching strategies, printable worksheets, interactive games, and educational apps. Whether you are looking for ideas to engage your students, support your child's learning at home, or enhance your own teaching skills, "orientacionandujar.es" is a valuable resource that aims to inspire and empower educators and learners alike.
The website also features informative articles and blog posts on various educational topics, including special education, literacy, numeracy, and classroom management. It serves as a platform for educators to share their experiences, insights, and best practices, fostering a collaborative and supportive community. Additionally, "orientacionandujar.es" offers a collection of free downloadable resources, such as flashcards, graphic organizers, and lesson plans, making it a go-to destination for educators seeking high-quality teaching materials.
Furthermore, "orientacionandujar.es" provides guidance and support for parents, offering tips and strategies to help them actively participate in their child's education. From suggestions for creating a conducive learning environment at home to ideas for fun and educational activities, the website aims to empower parents to become effective partners in their child's learning journey.
In summary, "orientacionandujar.es" is a valuable online resource that offers a wealth of educational materials, resources, and support for teachers, parents, and students. With its diverse range of content and user-friendly interface, the website strives to promote effective teaching and learning, ultimately contributing to the academic success and personal growth of learners.
Rank by traffic
In March 2025, orientacionandujar.es saw a decrease in search traffic, reaching 240K visits, which is a decrease of 11K visits compared to the previous month. The traffic value decreased to 20K, a reduction of 18.
For orientacionandujar.es, Mexico dominates traffic with 87K visits, an increase of 14K from the previous month, making up 36.1% of the total traffic.
orientacionandujar.es ranks #1 for "frases para fichas descriptivas de alumnos de primaria" in Mexico and receives 1.6K monthly visits from this keyword alone, an increase of 813 from the previous month.
Keyword | Volume | Traffic | Position | ||||||
|---|---|---|---|---|---|---|---|---|---|
| frases para fichas descriptivas de alumnos de primaria | 2.6K | +1.3K | 1.6K | +813 | 1 | ||||
| ficha descriptiva del alumno | 5.1K | −1.2K | 1.3K | +23 | 2 → 1 | ||||
| problemas matematicos para quinto grado | 1.7K | 1.3K | −2 | 1 | |||||
| 10 palabras agudas | 4.4K | −6.6K | 1.1K | −1.6K | 1 | ||||
| palabras con tr | 2.8K | −5.2K | 976 | −1.8K | 1 | ||||
actividadesdeinfantilyprimaria.com, imageneseducativas.com and edufichas.com rank in the top 10 organic search results for the same keywords that orientacionandujar.es gets the most traffic from. Discover more competitors of orientacionandujar.es.
Website | Traffic | Pages | |||||||
|---|---|---|---|---|---|---|---|---|---|
| actividadesdeinfantilyprimaria.com | 43K | 4.3K | |||||||
| imageneseducativas.com | 109K | 6.2K | |||||||
| edufichas.com | 123K | 457 | |||||||
| aulapt.org | 31K | 2.2K | |||||||
| neoparaiso.com | 26K | 906 | |||||||
As of March 2025, orientacionandujar.es's Domain Rating is 59. orientacionandujar.es is linked by 26K websites, indicating an increase of 183 referring sites from the previous month.
Get an in-depth look at the organic search traffic and backlink profile of any website or URL.